PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0039s0141.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 365aa    MW: 39585.9 Da    PI: 7.726
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0039s0141.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.4e-33193248156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Kalax.0039s0141.2.p 193 KQRRCWSPELHRRFIHALQQLGGPHVATPKQIKELMKVDGLTNDEVKSHLQKYRLH 248
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-18190251IPR009057Homeodomain-like
PROSITE profilePS5129415.314190250IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-29191251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-27193248IPR006447Myb domain, plants
PfamPF002495.7E-8195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDFAEKMHKC SEYVEALEVE RRKIQVFRRE LPLCLELVSQ AIDACRQQLS TAAAAGTSRE  60
CFHVRRQQRS ECSEQTSCHG PVLEEFIPIK RAASCSSECE EEEDESSQKS GDKPAGKKSD  120
WLRSVQLWNQ SSDPAPASEV KKSVGAFRPF NKESKAVVAA AEMAERQPVE DKPASSTTLK  180
SRNEESGQAT QRKQRRCWSP ELHRRFIHAL QQLGGPHVAT PKQIKELMKV DGLTNDEVKS  240
HLQKYRLHMR RPGAAAPSSA IGVAPPDSAA PALEPAATTS SSDQPEANNS KKEARVYAPV  300
STVGTPYAQP ATQTSDQKVR SGSHCEEDDN GSHSTHGGAG AHCRSPASSS STHTTATASP  360
MPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-104PREDICTED: probable transcription factor GLK2
TrEMBLA0A0J8B7X91e-103A0A0J8B7X9_BETVU; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.15e-90G2-like family protein